Protein Info for GFF3384 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: MoxR-like ATPase in aerotolerance operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF20030: bpMoxR" amino acids 13 to 184 (172 residues), 62.7 bits, see alignment E=8e-21 PF00158: Sigma54_activat" amino acids 35 to 155 (121 residues), 25 bits, see alignment E=4.1e-09 PF07728: AAA_5" amino acids 43 to 171 (129 residues), 52 bits, see alignment E=2.3e-17 PF07726: AAA_3" amino acids 43 to 173 (131 residues), 216.5 bits, see alignment E=2.8e-68 PF17863: AAA_lid_2" amino acids 249 to 312 (64 residues), 64.9 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 85% identity to vap:Vapar_1243)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF3384 MoxR-like ATPase in aerotolerance operon (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDQSTAPDTAQLMEQILYEVKRVVVGQDRFLERVMVAMLAQGHLLVEGVPGLAKTLTVKT
LASVVQGRFKRIQFTPDLVPADLVGTRIYNQKTGDFSTSLGPVFANLLLADEINRAPAKV
QSALLEVMQERQVTIAGETHKVPNPFLVMATQNPIETEGTYPLPEAQVDRFMMKVMVDYP
TDEEEFVIVERVTGPAVNVNAVATTDQLAALQAQCRQVYVDPSLVQYAVKLVSATRAPEK
HGIKDMAHLITFGASPRATIGLVEGARALAMLRGRTYALPEDMTDLVPDVLRHRVVLSYE
GLSEGLTSEALIGRVMKHIPAPARPLEHEKKVA