Protein Info for PS417_17315 in Pseudomonas simiae WCS417

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 116 to 122 (7 residues), see Phobius details amino acids 126 to 127 (2 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 460 to 479 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 38 to 472 (435 residues), 303.6 bits, see alignment E=1.2e-94

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 99% identity to pfs:PFLU3941)

Predicted SEED Role

"Possible pyrimidine permease in reductive pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYV7 at UniProt or InterPro

Protein Sequence (495 amino acids)

>PS417_17315 nitrate reductase (Pseudomonas simiae WCS417)
MQQNRSQVIERNGLYELDAGPDVLDSPRYNHDMAPTKVHERTWNKWHITALWVGMSICVP
TYTLGGVLTAYFGLSVGEALMAILLANIVVLIPLTLNAFPGTQYGIPFPVLLRSSFGILG
SNVPCLIRALVACGWFGIQTMFGGLAIHLFLGSIFEGWKSLGGTGEVIGFMMFWCLNLWV
VLRGAESIKRLETLSAPLLVAVGIGLLVWAMPNVSLSELMAIPAKRPEGASLTGYFMAGL
TAMVGFWATLSLNIPDFSRYAKSQKDQILGQIFGLPLTMFLFAALGVIMTAASVKLVGVS
VSDPVTLIGHIQSPVWVAVAMALIIVATLSTNTAANIVSPTNDFQNIAPKLINRTTAVIL
TGLVGLVLMGHELLKKLGLIVSDVSLETVYSNWLLGYSSLLGPIAGIMVVDYFITRKQQL
DLAGLYRDDVYPAWNWSGFIAFGVPVVLTLLSLGSDAFSWFYSYGWFTGSALGGLLYYGL
NARRGISPVAAKSPL