Protein Info for GFF3383 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: peptidase S1 and S6, chymotrypsin/Hap

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details PF13365: Trypsin_2" amino acids 127 to 266 (140 residues), 99.7 bits, see alignment E=2.7e-32 PF00089: Trypsin" amino acids 128 to 291 (164 residues), 51.3 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 62% identity to aav:Aave_1064)

Predicted SEED Role

"peptidase S1 and S6, chymotrypsin/Hap"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF3383 peptidase S1 and S6, chymotrypsin/Hap (Hydrogenophaga sp. GW460-11-11-14-LB1)
LYSPSTRPGVPKAGAQGGESAAEAPAAPAPRRRWRAAAARWAASPRVMWSALALLAALLA
ASAWQSGANGPKALTQKDIDAAVLRTLTTQNLPSRAARAAEKIRPAVVRVMSYAKDKKGE
EQEMGVGTGVVIVDKGIILTNLHVVQHAQSIKLVFADGTESGASITGVQAQNDLAVLQAH
TIPDDLIAATMRSTGDLLPGDEVVAVGFPFGIGPSTSSGVISGFDRAFKSPEGEQEIGNL
IQFDAAANPGNSGGPLVTMDGEVVGIVTGILNPTSHRTFLGIGFAVPIESAASAAGLPPF