Protein Info for PS417_17295 in Pseudomonas simiae WCS417

Annotation: RND transporter MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 53 to 376 (324 residues), 214.8 bits, see alignment E=7.2e-68 PF13533: Biotin_lipoyl_2" amino acids 79 to 125 (47 residues), 37 bits, see alignment 3.5e-13 PF16576: HlyD_D23" amino acids 79 to 296 (218 residues), 77.5 bits, see alignment E=1.4e-25 PF13437: HlyD_3" amino acids 188 to 293 (106 residues), 43 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU3937)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8L6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>PS417_17295 RND transporter MFP subunit (Pseudomonas simiae WCS417)
MSSDHKPSRKRLMLMGVGGLTLAALLVANGLHARTLHEQSVTAWTETAAIPQVRVFQPQQ
NAAGDTLRLPAHLEAWSKAPIHARVSGYLKDWKADIGTQVKAGQILAEIDSPDLDQQMAQ
THARLIQEQANARLAQTTATRWQNLLASHSVSRQEADEKTSNAAAAKANAEAAAADYARL
SALESYKTIRAPFAGTITARNTDIGQLIKADTDSDPELFNIADTHQLRLYVPVPQNYAAV
IHPGLEAELTVPEHPGEHFKARLIGDSTAIDRRSGTLLAQFVADNPNGELLPGDYAEATL
PIPADTHGVSIPASALIFRAQGTQVAVLDAHNHVHLQTIHIGLDLGERLVIDQGLKPVDR
VVDNPPDALREGDPVQLADASGGAHAPKA