Protein Info for GFF3376 in Xanthobacter sp. DMC5

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00857: Isochorismatase" amino acids 22 to 210 (189 residues), 158 bits, see alignment E=1.3e-50

Best Hits

KEGG orthology group: None (inferred from 82% identity to pgv:SL003B_1964)

MetaCyc: 74% identical to biuret amidohydrolase subunit (Rhizobium leguminosarum bv. viciae 3841)
Biuret amidohydrolase. [EC: 3.5.1.84]

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1 or 3.5.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF3376 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (Xanthobacter sp. DMC5)
VPVIAADPYSWPFDGVISPKDTALVVIDMQTDFCGPGGYVDAMGYDISLTRAPLEPISRV
LAAMRAAGYWIIHTREGHRPDLSDLPENKRWRSRQIGAGIGDPGPCGKVLVRGEAGWEIV
PELAPLPGEIVIDKPGKGSFYATDLEMILRTRGIRNLVLTGITTDVCVHTTMREANDRGF
ECLLLEDCCGATDAGNHAAAVKMVKMQGGVFGAVSNADDFIAALPA