Protein Info for GFF3376 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12840: HTH_20" amino acids 25 to 73 (49 residues), 29.4 bits, see alignment E=2e-10 PF13412: HTH_24" amino acids 26 to 71 (46 residues), 26.9 bits, see alignment E=8.9e-10 PF01022: HTH_5" amino acids 27 to 72 (46 residues), 47.5 bits, see alignment E=3.9e-16 PF01047: MarR" amino acids 28 to 72 (45 residues), 25.8 bits, see alignment E=2.3e-09 PF12802: MarR_2" amino acids 31 to 76 (46 residues), 28 bits, see alignment E=6.2e-10

Best Hits

Swiss-Prot: 50% identical to YGAV_ECOLI: Probable HTH-type transcriptional regulator YgaV (ygaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to rme:Rmet_2370)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>GFF3376 Transcriptional regulator, ArsR family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATRKDAQFLQTGAAQAAALLRAVGNEHRLLVLCLLIEHGEMTVGALLEQVPLSQSALSQ
HLAKMRDEGLVAYRRESQTLHYRIENPDVARLIATLKSIFCP