Protein Info for GFF3371 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 PF13175: AAA_15" amino acids 1 to 64 (64 residues), 42.3 bits, see alignment E=2.4e-14 PF13476: AAA_23" amino acids 5 to 50 (46 residues), 34.6 bits, see alignment 9.4e-12 PF11398: DUF2813" amino acids 19 to 162 (144 residues), 34.3 bits, see alignment E=5.6e-12 PF13304: AAA_21" amino acids 255 to 358 (104 residues), 35.5 bits, see alignment E=3.8e-12 PF20469: OLD-like_TOPRIM" amino acids 407 to 470 (64 residues), 54.8 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 63% identity to ppu:PP_3680)

Predicted SEED Role

"putative exonuclease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>GFF3371 hypothetical protein (Pseudomonas sp. DMC3)
MKLQSIRLCNFQSFGNEPTVITFEDVTYLIGPNGSGKTAVLQALCRLFAFDPSLRRIKRS
DFHVPADEDLVPEERSLWLEADFEFPELLEDEDNSTVAPHFAHMRLDTAEAIPRARYRLS
ATMGIDGDIEENLVYVLDVDKDANPLSTAVVTRVHRNTIQMHYLPARRDPADHITYGANA
LLGRLLRAVNWEDDRERIKGLTDEISECLSGNQSVSAFSESLNLMWKRLHKGTFFTDPKL
TFVTSEIESLLRHMSVSFSPGHDENLVDFSRLSDGQKSMLYLSLVLSSHAIGRAVLTGKD
VSFDADKLKPPSFTLIAVEEPENSLSPHYLGRIVNALNSSIGGADSQAIIATHAPSMLRR
VDPENIRYLRLAANRATKVTCIALPDKEDEAHKFVREAVQAFPEVYFSRLVVLGEGDSEE
IVLPRILQAKGAPVDESAVTIAPLGGRHVNHFWRLLSALETPYVTLLDLDVARHQGGWGR
VTNVNNQLAKFAPEKKLPAWNIAKWNDDLPVRTHHWFEEGKVSVFVELEKRGVFFSEPMD
LDFSMLLAYPNAYDVSLSDPDESTVKAVLGKSHHKSDQYNAAEQQLFGTYHSKFKLGSKP
AAHISALAKLTDEDLLKALPPSLDRLANAIIAALEDIPE