Protein Info for GFF3366 in Variovorax sp. SCN45

Annotation: Septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF10609: ParA" amino acids 2 to 245 (244 residues), 59.9 bits, see alignment E=9.2e-20 TIGR01968: septum site-determining protein MinD" amino acids 2 to 268 (267 residues), 352.7 bits, see alignment E=5.9e-110 PF13614: AAA_31" amino acids 3 to 160 (158 residues), 66.4 bits, see alignment E=1.1e-21 PF09140: MipZ" amino acids 4 to 164 (161 residues), 33.5 bits, see alignment E=1e-11 PF01656: CbiA" amino acids 5 to 226 (222 residues), 68.1 bits, see alignment E=2.5e-22 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 28.1 bits, see alignment 4.3e-10

Best Hits

Swiss-Prot: 73% identical to MIND_ECO57: Septum site-determining protein MinD (minD) from Escherichia coli O157:H7

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 98% identity to vpe:Varpa_0074)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>GFF3366 Septum site-determining protein MinD (Variovorax sp. SCN45)
MAKIVVVTSGKGGVGKTTTSASFASGLALAGKKTAVIDFDVGLRNLDLIMGCERRVVYDL
INVIQGEANLSQALIKDKQCENLFVLAASQTRDKEALTQEGVEKVLTDLAAMDFEYIVCD
SPAGIETGAMMAMHFADEALIVTNPEVSSVRDSDRILGMLSSKTKRAKDGSDPIKEHLLI
TRYNPNRVAGGQMLSLEDIQDILRIKLIGVIPESESVLHASNQGVPAIHDKDTDVAQAYS
DVVARFLGEEKPMRFVDAEKPGFFKRIFGGK