Protein Info for GFF3364 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar hook-associated protein FlgL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR02550: flagellar hook-associated protein 3" amino acids 2 to 191 (190 residues), 233.2 bits, see alignment E=3.3e-73 PF00669: Flagellin_N" amino acids 3 to 141 (139 residues), 133.7 bits, see alignment E=2.4e-43

Best Hits

Swiss-Prot: 100% identical to FLGL_SALTY: Flagellar hook-associated protein 3 (flgL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02397, flagellar hook-associated protein 3 FlgL (inferred from 99% identity to sew:SeSA_A1252)

Predicted SEED Role

"Flagellar hook-associated protein FlgL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF3364 Flagellar hook-associated protein FlgL (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRISTQMMYEQNMSGITNSQAEWMKLGEQMSTGKRVTNPSDDPIAASQAVVLSQAQAQNS
QYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRDQ
LMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIGHTGAQIF
NSITSNAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKTNRGLKNSL
NNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSVISSYVMQQAALQAS
YKTFTDMQGMSLFQLNR