Protein Info for GFF336 in Sphingobium sp. HT1-2

Annotation: Large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details PF01741: MscL" amino acids 3 to 143 (141 residues), 137.9 bits, see alignment E=1.2e-44 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 143 (141 residues), 114.4 bits, see alignment E=2e-37

Best Hits

Swiss-Prot: 69% identical to MSCL_BURM1: Large-conductance mechanosensitive channel (mscL) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 84% identity to sch:Sphch_1658)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>GFF336 Large-conductance mechanosensitive channel (Sphingobium sp. HT1-2)
MGLISEFKTFINRGNVMDLAVGVIIGGAFATITKSLTDDLIMPVVGYLFGGADFSGYFLR
LGDLPEGFKGNPNSYADLKAAGVAMFGWGQFLTVLVNFIILAFIIFLLVKLVNKVLAKPE
EAPAPAVTPEDIVLLREIRDSLKK