Protein Info for GFF3357 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 385 (385 residues), 324.2 bits, see alignment E=7.8e-101 PF00460: Flg_bb_rod" amino acids 6 to 33 (28 residues), 29.8 bits, see alignment (E = 6.9e-11) PF07559: FlaE" amino acids 173 to 284 (112 residues), 75.8 bits, see alignment E=7.3e-25 PF06429: Flg_bbr_C" amino acids 325 to 402 (78 residues), 71.1 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 100% identical to FLGE_SALTY: Flagellar hook protein FlgE (flgE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to sek:SSPA1556)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF3357 Flagellar hook protein FlgE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQD
FTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYP
ATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNK
KGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILES
GGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTV
VGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGA
LEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR