Protein Info for GFF3356 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar basal-body rod modification protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF03963: FlgD" amino acids 11 to 79 (69 residues), 76.3 bits, see alignment E=2.5e-25 PF13861: FLgD_tudor" amino acids 88 to 229 (142 residues), 51.4 bits, see alignment E=1.6e-17 PF13860: FlgD_ig" amino acids 120 to 190 (71 residues), 80.9 bits, see alignment E=8.4e-27

Best Hits

Swiss-Prot: 100% identical to FLGD_SALTI: Basal-body rod modification protein FlgD (flgD) from Salmonella typhi

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 99% identity to ses:SARI_01821)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>GFF3356 Flagellar basal-body rod modification protein FlgD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSIAVNMNDPTNTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTT
QLAQISTVSGIEKLNTTLGAISGQIDNSQSLQATTLIGHGVMVPGTTILAGKGAEEGAVT
STTPFGVELQQPADKVTATITDKDGRVVRTLEIGELRAGVHTFTWDGKQTDGTTVPNGSY
NIAITASNGGTQLVAQPLQFALVQGVTKGSNGNLLDLGTYGTTTLDEVRQII