Protein Info for GFF3355 in Xanthobacter sp. DMC5

Annotation: Nitrilotriacetate monooxygenase component A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 13 to 432 (420 residues), 500.3 bits, see alignment E=2.2e-154 PF00296: Bac_luciferase" amino acids 23 to 389 (367 residues), 136.4 bits, see alignment E=7.4e-44

Best Hits

KEGG orthology group: None (inferred from 56% identity to mms:mma_3466)

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>GFF3355 Nitrilotriacetate monooxygenase component A (Xanthobacter sp. DMC5)
MPRPMHLCGFLIAGPVVHSHAIWRNPAHDTPFLSLDHYVRIARLLEQGCFDFLFFADRLA
IADRYGDSHAAGLARGDQDATRMDPMPILGAMAAVTRHIGLGATRSTTYDAPYNIAREFA
TLDHISTGRAAWNVVTSMNDGEALNFGTVPHLGHDERYDRADEFMELAFRLWDSWDEDAL
VLDRAAGIYADPAKVHYVNHRGPWFQSRGPLNIPRSPQGRPVIVQAGSSGRGKAFAARWS
DVIFALQPNLERMHAFKADVAGALEAAGRPPGASKVLMAIMPFIGATRAEAEEKEALHDS
LADPVAGLSTLAAHANTDFSSLPMDATVKEIAASGSQGNLAALRSITPDGGMTIAEAGGV
YARGVMCPRAVGTAAEVADQLIAIIDSGAADGFVVSPAFLPDTFEDFVREVVPLLQARGY
LRRGYAGGQLRDLLAEGAA