Protein Info for GFF3351 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Negative regulator of flagellin synthesis FlgM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03824: flagellar biosynthesis anti-sigma factor FlgM
  • amino acids 1 to 90 (90 residues), 67.1 bits, E=9.8e-23
• PF04316: FlgM
  • amino acids 40 to 87 (48 residues), 41.8 bits, E=5e-15

Best Hits

Swiss-Prot: 100% identical to FLGM_SALTY: Negative regulator of flagellin synthesis (flgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02398, negative regulator of flagellin synthesis FlgM (inferred from 98% identity to ses:SARI_01825)

Predicted SEED Role

"Negative regulator of flagellin synthesis FlgM" in subsystem Flagellum

Protein Sequence (97 amino acids)

>GFF3351 Negative regulator of flagellin synthesis FlgM (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSIDRTSPLKPVSTVQTRETSDTPVQKTRQEKTSAATSASVTLSDAQAKLMQPGVSDINM
ERVEALKTAIRNGELKMDTGKIADSLIREAQSYLQSK