Protein Info for GFF3349 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Proposed peptidoglycan lipid II flippase MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 96 to 123 (28 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 454 to 479 (26 residues), see Phobius details amino acids 491 to 514 (24 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 15 to 522 (508 residues), 581.2 bits, see alignment E=9.5e-179 PF03023: MurJ" amino acids 41 to 491 (451 residues), 536.6 bits, see alignment E=2.2e-165

Best Hits

Swiss-Prot: 100% identical to MURJ_SALTY: Probable lipid II flippase MurJ (murJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03980, virulence factor (inferred from 100% identity to sei:SPC_2579)

MetaCyc: 94% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>GFF3349 Proposed peptidoglycan lipid II flippase MurJ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQEFYARVWNTKEMNLLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKL
PNLLRRIFAEGAFSQAFVPILAEYKSKQGEEATRIFVAYVSGLLTLALAVVTVAGMLAAP
WVIMVTAPGFADTADKFALTTQLLRITFPYILLISLASLVGAILNTWNRFSIPAFAPTFL
NISMIGFALFAAPYFNPPVLALAWAVTVGGVLQLVYQLPYLKKIGMLVLPRINFRDTGAM
RVVKQMGPAILGVSVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTIL
LPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFDA
AMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIMTQLMNLAFIGPLKH
AGLSLSIGLAACLNASLLYWQLRKQNIFTPQPGWMWFLMRLIISVLVMAAVLFGVLHIMP
EWSQGSMLWRLLRLMAVVIAGIAAYFAALAVLGFKVKEFVRRTA