Protein Info for GFF3346 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribosomal-protein-S5p-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF13302: Acetyltransf_3" amino acids 17 to 162 (146 residues), 75.3 bits, see alignment E=1.2e-24 PF13420: Acetyltransf_4" amino acids 21 to 181 (161 residues), 36.9 bits, see alignment E=5.6e-13 PF00583: Acetyltransf_1" amino acids 54 to 161 (108 residues), 45.7 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 95% identical to RIMJ_ECO57: [Ribosomal protein S5]-alanine N-acetyltransferase (rimJ) from Escherichia coli O157:H7

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to sea:SeAg_B2021)

MetaCyc: 95% identical to ribosomal-protein-S5-alanine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-18434 [EC: 2.3.1.267]

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128 or 2.3.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>GFF3346 Ribosomal-protein-S5p-alanine acetyltransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFGYRSNVPKVRLTTDRLVVRLVHERDAWRLADYYAENRHFLKPWEPVRDESHCYPSGWQ
ARLGMIGEFHKQGSAFYFALLDPEEKEIIGVANFSNVVRGSFHACYLGYSIAQKWQGQGL
MFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGALLARLGFEKEGYAKDYLLIDGQWRDH
VLTALTTPLWTPGR