Protein Info for GFF3339 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF07638: Sigma70_ECF" amino acids 2 to 180 (179 residues), 30.5 bits, see alignment E=6.5e-11 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 2 to 189 (188 residues), 245.4 bits, see alignment E=4.6e-77 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 182 (170 residues), 101.4 bits, see alignment E=4e-33 PF04542: Sigma70_r2" amino acids 17 to 82 (66 residues), 58.7 bits, see alignment E=8.3e-20 PF08281: Sigma70_r4_2" amino acids 129 to 180 (52 residues), 66 bits, see alignment E=3.9e-22 PF04545: Sigma70_r4" amino acids 134 to 180 (47 residues), 40 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 78% identity to pol:Bpro_3643)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>GFF3339 RNA polymerase sigma factor RpoE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLVQRTLAGEQRAFEMLVVKYQRRVERLIGRMVRDTDLVQDIAQETFIRAYRALAQFRGD
AQFYTWLYRIAVNTAKKQLMELKRDPLVFQSQMKSGEDDETSGPERELNSGVADTETPEA
VLASKEIAEAVNAAMDALPEELRMAITLREIEGMSYEEIATALECPIGTVRSRIFRAREA
ISGRIKPMLERQTGKRW