Protein Info for GFF3339 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: N-methyl-L-amino-acid oxidase (EC 1.5.3.2); N-methyl-L-tryptophan oxidase (EC 1.5.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF01266: DAO" amino acids 4 to 351 (348 residues), 171.4 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 100% identical to MTOX_SALTY: N-methyl-L-tryptophan oxidase (solA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02846, N-methyl-L-tryptophan oxidase [EC: 1.5.3.-] (inferred from 99% identity to sed:SeD_A2212)

MetaCyc: 85% identical to N-methyl-L-tryptophan oxidase (Escherichia coli K-12 substr. MG1655)
N-methyl-L-amino-acid oxidase. [EC: 1.5.3.2]

Predicted SEED Role

"N-methyl-L-amino-acid oxidase (EC 1.5.3.2); N-methyl-L-tryptophan oxidase (EC 1.5.3.-)" (EC 1.5.3.-, EC 1.5.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.3.- or 1.5.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>GFF3339 N-methyl-L-amino-acid oxidase (EC 1.5.3.2); N-methyl-L-tryptophan oxidase (EC 1.5.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKYDLIIIGSGSVGAAAGYYATRAGLKVLMTDAHMPPHQQGSHHGDTRLIRHAYGEGEKY
VPLVLRAQTLWDELSTHNEEPIFVRSGVVNLGPADSAFLANVARSAQQWQLNVERLDATA
LMTRWPEIRVPDNYIGLFEADSGFLRSELAITTWLRLAREAGCAQLFNSPVSHIHHDDNG
VTIETSEGCYHASKALISAGTWVKALVPELPVQPVRKVFAWFKADGRYSTKNRFPAFTGE
MPNGDQYYGFPAENDELKIGKHNGGQLIQAPEERKPFAAVASDGAEAFPFLRNVLPGIGG
CLHGAACTYDNSPDEDFIIDTLPGHENTLVITGLSGHGFKFAPVLGEIAADFALGKTPSF
DLTPFRLSRFSQ