Protein Info for GFF3338 in Variovorax sp. SCN45

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 69 (29 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 144 to 171 (28 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 203 (187 residues), 107 bits, see alignment E=4.5e-35

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0047)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF3338 Threonine efflux protein (Variovorax sp. SCN45)
MFGIADYGAFVAAIVLFLLIPGPGNLALITSTSKGGIRGGLAATTGVILGDQCLMWAAVA
GVSAVLAAYPAAFKAVQWLGAVYLGWLGLKMLLAKPGSAPILNIKPSHFMRQAFTITLLN
PKAIVFYMAFFPLFVDPARHQGLITFGAMAVTIAALTFLYGLTSTLLTHFLAERIRANPR
ISGTLEKLAGTFLIAFGVKLAISR