Protein Info for GFF3337 in Variovorax sp. SCN45

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase (EC 2.1.1.170)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02527: GidB" amino acids 11 to 188 (178 residues), 161.7 bits, see alignment E=6.3e-52 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 14 to 192 (179 residues), 153.2 bits, see alignment E=2.9e-49

Best Hits

Swiss-Prot: 64% identical to RSMG_ACIET: Ribosomal RNA small subunit methyltransferase G (rsmG) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 90% identity to vap:Vapar_0046)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>GFF3337 16S rRNA (guanine(527)-N(7))-methyltransferase (EC 2.1.1.170) (Variovorax sp. SCN45)
MGVALSDQQGEQLLAYGTLMLKWNKVYNLTALRDPASVLTHHLLDSLAAIAPLQREWAGK
GKLLDVGSGGGLPGVVIAIMRPDIDVSCLDAVAKKAAFVQQVAAELELPNLRGLHARVES
LTGSYDVISSRAFASLPDFFNGSVHLLAPGAVWLAMKGKVPADELAALPKGVAVFHVEQL
TVPGLGAERCIVWARNESA