Protein Info for GFF3334 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Rhodanese domain protein, Enterobacterial subgroup, YceA homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF17773: UPF0176_N" amino acids 25 to 117 (93 residues), 77.3 bits, see alignment E=1.4e-25 PF00581: Rhodanese" amino acids 138 to 231 (94 residues), 57.2 bits, see alignment E=3e-19 PF12368: Rhodanese_C" amino acids 246 to 307 (62 residues), 73 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 100% identical to YCEA_SALTY: UPF0176 protein YceA (yceA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07146, UPF0176 protein (inferred from 100% identity to stm:STM1156)

MetaCyc: 89% identical to tRNA U34 hydroxylase TrhO (Escherichia coli K-12 substr. MG1655)
RXN0-7349

Predicted SEED Role

"Rhodanese domain protein, Enterobacterial subgroup, YceA homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF3334 Rhodanese domain protein, Enterobacterial subgroup, YceA homolog (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYL
AHEGINAQISVPQSKLETFRQQLYTFDPALDGVRLNIALEDDGKSFWVLRMKVRDRIVAD
GIDDPTFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYEYEVGHFENALEIPADTFREQ
LPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRARAQGL
PVRFIGKNFVFDERMGERISDEVIAHCHQCGASCDSHTNCKNDGCHLLFIQCPQCASKFN
GCCSEQCCEELALPEEEQRRRRAGRENGNKIFNKSRGRLNSKLSIPDPAE