Protein Info for GFF3330 in Xanthobacter sp. DMC5

Annotation: Bicarbonate transport ATP-binding protein CmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00005: ABC_tran" amino acids 23 to 162 (140 residues), 116.9 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 46% identical to SSUB_BACLD: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 78% identity to mno:Mnod_3418)

MetaCyc: 44% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, ATPase component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF3330 Bicarbonate transport ATP-binding protein CmpD (Xanthobacter sp. DMC5)
MAYLSISGVRKTYGSPRGPVTALKGIDLEVNEGEFVSILGPSGCGKSTLLKCIAGLEDAS
AGKIAVDGRALKGPPQNMGIVFQRDVLLDWRTILDNVLITAEFAGLKGPAVRERALALLG
RFGLGGFESRHPWELSGGMRQRAAICRALLCDPKLLLMDEPFGALDAMTRDDLNLELARI
WQDTRKTVVFVTHGITEAIFLSDRVVMMDRNPGRIVEIIDIDLPRPRHLAVRESAEFGRY
VAHVRHLFASLGVLKDDAP