Protein Info for GFF3322 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Major curlin subunit precursor CsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07012: Curlin_rpt" amino acids 40 to 74 (35 residues), 32.1 bits, see alignment 4.6e-12 amino acids 67 to 96 (30 residues), 26.4 bits, see alignment 2.6e-10 amino acids 86 to 119 (34 residues), 39.4 bits, see alignment 2.3e-14 amino acids 110 to 141 (32 residues), 30.4 bits, see alignment 1.5e-11

Best Hits

Swiss-Prot: 100% identical to CSGA_SALTI: Major curlin subunit (csgA) from Salmonella typhi

KEGG orthology group: K04334, major curlin subunit (inferred from 99% identity to seg:SG1978)

Predicted SEED Role

"Major curlin subunit precursor CsgA" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>GFF3322 Major curlin subunit precursor CsgA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLLKVAAFAAIVVSGSALAGVVPQWGGGGNHNGGGNSSGPDSTLSIYQYGSANAALALQ
SDARKSETTITQSGYGNGADVGQGADNSTIELTQNGFRNNATIDQWNAKNSDITVGQYGG
NNAALVNQTASDSSVMVRQVGFGNNATANQY