Protein Info for GFF332 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Mg(2+) transport ATPase protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 95 to 123 (29 residues), see Phobius details PF02308: MgtC" amino acids 8 to 127 (120 residues), 135.7 bits, see alignment E=1.1e-43 PF21770: MgtC_SapB_C" amino acids 143 to 220 (78 residues), 47.3 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 100% identical to MGTC_SALT1: Protein MgtC (mgtC) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 99% identity to sek:SSPA3376)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF332 Mg(2+) transport ATPase protein C (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPDSPGRIA
AQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATIIILCAN
ILLREAAQRINQLPISAEGEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQGLGSVPA
QEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ