Protein Info for GFF3317 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Curli production assembly/transport component CsgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03783: CsgG" amino acids 33 to 270 (238 residues), 307 bits, see alignment E=4e-96

Best Hits

Swiss-Prot: 100% identical to CSGG_SALTI: Curli production assembly/transport component CsgG (csgG) from Salmonella typhi

KEGG orthology group: K06214, curli production assembly/transport component CsgG (inferred from 100% identity to sei:SPC_2611)

Predicted SEED Role

"Curli production assembly/transport component CsgG" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF3317 Curli production assembly/transport component CsgG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPRLLILVAVLLLSGCLTAPPKQAAKPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDET
GQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTV
AMNNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVN
VSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEIGYTSNEPVMLCLMSAIETGVI
FLINDGIDRGLWDLQNKADRQNDILVKYRELSVPPES