Protein Info for PS417_16970 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 27 to 99 (73 residues), 64.7 bits, see alignment E=9.9e-22 PF07244: POTRA" amino acids 188 to 249 (62 residues), 34.8 bits, see alignment E=3.3e-12 PF01103: Omp85" amino acids 289 to 572 (284 residues), 127 bits, see alignment E=1.8e-40

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 96% identity to pfs:PFLU3880)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U390 at UniProt or InterPro

Protein Sequence (575 amino acids)

>PS417_16970 membrane protein (Pseudomonas simiae WCS417)
MKFPGRFTSGLILLFTSCGALAQSELDVRVKPSNDALKANIEGYIGGVGDRDEEALLRFS
RGAEEQARKAAQALGFYQPRIESDVKGGNNPRLILTIDPGEPVHLRNVTIRVDGPAADLK
AFRVPVSNDLKSGAVLNHGHYEDAKRLIQNQASRYGFFSGRFTRQKLAVDPQAGVADIEL
IYDSGPRYTLGKVSFAGDTPFDEELLHRMVPFKSGTPYDSELIAELNQNLQASGFFEGVR
VDAAPAASTNDIIPVAVRLETRKPRTMGLGLGFSTDVGPRGKANWTRHWVNPQGHSYGWE
AELSAPRQNVGLWYDIPLDPPLTDKLRFAGGYQNEEIANTDTVSKLLTLGPEWHSKLPSG
WTRVISLKYQREEYRLGNDSGLSNLVMPGVSYSYLRSDNRIDPHNGYRLQFDTKVAKEGL
GSDTNLLYGTALVKGLTTLWDNHRFLARAQVGGSATNGYKSVPPSLRFFAGGDQSVRGYE
YQTLSPENDRGDRVGGRYMVALSAEYQYSIAEKWRIATFIDQGNSFNNLDLPSLKTGVGV
GIRWVSPVGPIRLDLAHALEDPGGIRLHFSMGPEL