Protein Info for GFF3306 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 54 to 69 (16 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF09721: Exosortase_EpsH" amino acids 51 to 274 (224 residues), 68.4 bits, see alignment E=3.4e-23 TIGR04178: exosortase/archaeosortase family protein" amino acids 190 to 277 (88 residues), 43.3 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_0022)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF3306 hypothetical protein (Variovorax sp. SCN45)
MSLAALAHRHPRIVDWGIFIDRAPAAGWLGLQFLALMPTWAWMVQRMRDGSDDPLGLLAL
VALAALTWNRRRELRASPRLGWLALAGAGTVLATLLRTGLGGLPALPPLAAGLVAVLALA
CGLLAFLPRNVGRLPLAGLAVLALPLLSSLQFYAGYPLRVVTAEASRWLLAPGFEVMREG
ASLMVDGRLVIVDAPCSGVQMVWLGYFTACAVALWARRGDQTFLRRLPMVGLLVLAGNIV
RNSLLIAFEGAGHPLAPWAHNTLGLVVLAVVCGAIARLMVPERHVPGLAEQPIPGLITAQ
GGRRVDTVL