Protein Info for GFF3306 in Pseudomonas sp. DMC3

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details signal peptide" amino acids 50 to 50 (1 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 54 to 184 (131 residues), 70 bits, see alignment E=5e-23 PF07695: 7TMR-DISM_7TM" amino acids 196 to 398 (203 residues), 91.1 bits, see alignment E=2.4e-29 PF00512: HisKA" amino acids 422 to 487 (66 residues), 73 bits, see alignment 4e-24 PF02518: HATPase_c" amino acids 534 to 648 (115 residues), 58.5 bits, see alignment E=2.1e-19 PF00072: Response_reg" amino acids 668 to 784 (117 residues), 67.4 bits, see alignment E=3.1e-22 amino acids 818 to 932 (115 residues), 80.6 bits, see alignment E=2.5e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_0611)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (950 amino acids)

>GFF3306 Sensor histidine kinase RcsC (Pseudomonas sp. DMC3)
MPFLAGLFGRRASLYSGINLRRDFAVRWLRIAISFTVTLMTLLCTLPAQAAQGSGWSVLL
DDQGILQLSDIRSARYTNQFSPIELDRLTAAEPDGALWLRFKLAPGKHEQVLRIFAPDLS
QLNLYVLDGDRLIEQRNTGNERPQAEHPLPSSDFMLPLPQADKPLDVYVRMVSGHQLRPH
ITLQAAIEGAADQKQTLIFGLLFGCLAMLLLHNLVRYAYSRSRSSLWLAICEGLLGLSLF
LLLNLAGPWLPNWQAIQTPGAYLALLLTAPAGLMFALRFFAPLGQHALNKLLWGDILLIV
TCSLLLLFVNTLPLNIITYALVALAGLSMLLVGFYHWQKGYRPARLFVAAMVVFNIGTLV
ILPALLGLTLVTPQGLIMTLMVFICISGLLMSIALGERQRSITESRFSISRDLAASNAEI
NAKAEFLAKISHEIRTPMNGVLGMTELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILD
ISKLESGQIELDDVQFDLNALIDDCLSIYRAKAEQQNVELISFIQPQVPRVISGDPTRLR
QTLLSLLENALKKTEEGEVLIVVALDERSSKPRLRIAVQDSGVPMEPEEREALLHAELHS
KHFLSANRLGGNLGLVIARQLIRLMQGEFGIKSGATQGSTLWLTLPLDPDRLEHPTSDLD
SPLQGARVLVVDDNDTCRKVLLQQCSAWGLNVSAVPSGKEALALLRTKAHLRDYFDVVLL
DQNMPGMTGMQLAAKIKEDPSLNHDILLIMLTGISNAPSKIIARNSGIKRILAKPVAGYT
LKTTLADELNQRNKGQVVFQPQVVTAATAAKVPSDFRILVAEDNTISTKVIRGMLGKLNL
QPDTASNGEEALQAMKAQRYDLVLMDCEMPILDGFSATQQLRAWEVSNQRIRTPIVALTA
HILAEHKERARQAGMDGHMSKPVELSQLRELIEHWVAERDQQNRATTQPS