Protein Info for GFF3306 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Predicted sialic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 315 to 340 (26 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 38 to 443 (406 residues), 228.3 bits, see alignment E=9.1e-72 PF00474: SSF" amino acids 38 to 442 (405 residues), 144.6 bits, see alignment E=2.1e-46

Best Hits

Swiss-Prot: 72% identical to NANT_ALIF1: N-acetylneuraminate transporter (nanT) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to seg:SG1016)

Predicted SEED Role

"Predicted sialic acid transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF3306 Predicted sialic acid transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MITHSFGIVNYLVLFGYLLAMMLVGVYFSRRQKTADDYFRGGGRVPGWAAGVSVFATTLS
SITFMSIPAKAFTSDWTFIIGQYLAIAILPLVFYFYIPFFRKLKVTSAYEYLEARFDVRC
RLFASMSFMLFHIGRIAIITFLTVLALRPFIAIDPVILVLLISVMCIIYTWMGGIEGVIW
TDVIQGLLLSGSAILIFIVICLKVQGGIDEIFTVTQQADKFFPATQFHWSWTESTVPVLM
IGFLFANIQQFTASQDVVQRYIVTDSIEETKKTLLTNAKLVAVIPVFFFAIGSALFVYYQ
QHPQLLPAGFNTGGILPLFVVTEMPVGIAGLIIAAIFAAAQSSISSSLNSISSCFNSDIY
QRLSHKKRTPENRMKIAKLVILVAGLISSAASVWLVMADESEIWDAFNSLIGLMGGPMTG
LFMLGIFFKRANAGSAVLGIIISVITVLGARYATDLNFFFYGVIGSLSVVISGVIFAPLF
APAPPLTLDEKPEPKVTL