Protein Info for GFF3300 in Xanthobacter sp. DMC5

Annotation: Arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 6 to 118 (113 residues), 140.1 bits, E=2.1e-45
• PF03960: ArsC
  • amino acids 9 to 115 (107 residues), 71.7 bits, E=2.6e-24

Best Hits

Swiss-Prot: 60% identical to ARSI1_SYNY3: Arsenate reductase ArsI1 (arsI1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 74% identity to azc:AZC_4550)

MetaCyc: 62% identical to arsenate reductase (glutathione/glutaredoxin) (Sinorhizobium meliloti)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (1/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (2/6 steps found)
• arsenic detoxification (yeast) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Protein Sequence (137 amino acids)

>GFF3300 Arsenate reductase (Xanthobacter sp. DMC5)
MSDFPITIYHNPRCGTSRNTLAMIRAAGTEPTVIEYLKTGWTKAQLKALAAATGAPLRDL
LRAKEPLVAELKLTGPDVTDDALLDAMVEHPILVNRPIVVTPKGTRLCRPSELVLDLLET
APESFTKEDGEVVKRPR