Protein Info for PS417_16890 in Pseudomonas simiae WCS417

Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 457 (456 residues), 600.3 bits, see alignment E=1.5e-184 PF01406: tRNA-synt_1e" amino acids 15 to 313 (299 residues), 469.3 bits, see alignment E=1.8e-144 PF09334: tRNA-synt_1g" amino acids 35 to 136 (102 residues), 20.7 bits, see alignment E=4.7e-08 amino acids 246 to 309 (64 residues), 26.1 bits, see alignment E=1.1e-09 PF00133: tRNA-synt_1" amino acids 222 to 304 (83 residues), 26.1 bits, see alignment E=1.1e-09 PF09190: DALR_2" amino acids 340 to 394 (55 residues), 70.1 bits, see alignment 5.6e-23 PF23493: CysS_C" amino acids 412 to 457 (46 residues), 45.5 bits, see alignment 2e-15

Best Hits

Swiss-Prot: 98% identical to SYC_PSEFS: Cysteine--tRNA ligase (cysS) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 98% identity to pfs:PFLU3871)

MetaCyc: 62% identical to cysteine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Cysteine--tRNA ligase. [EC: 6.1.1.16]

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDQ2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>PS417_16890 cysteinyl-tRNA synthetase (Pseudomonas simiae WCS417)
MLTIYNTLSKTKEVFKPLDGNKVRMYVCGMTVYDYCHIGHGRSMVAFDLVTRWLRFSGYD
LTYVRNITDIDDKIINRANENGESFDALTERMIAAMHEDEARLNILKPDMEPRATDHIPG
MHAMIQTLIDKGYAYAPGNGDVYYRVAKFMGYGKLSRKKIEDLRIGARIEVDEAKQDPLD
FVLWKATKPGEPSWESPWGAGRPGWHIECSVMSTCCLGDTFDIHGGGSDLEFPHHENEIA
QSEAATGKTYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVSSHYRS
AINYSEDNLKDAKGALERFYHALKGLPAVAPAGGEAFVARFTEVMNDDFGTPEACAVLFE
MVREINRLRESDLDAAAGLAARLKELASVLGVLQMEADDFLQAGAEGRVDAAQVDALIQA
RLAARTNKDWAESDRIRDQLTAMGVVLEDGKGGTTWRLADQA