Protein Info for GFF3300 in Sphingobium sp. HT1-2

Annotation: Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR01251: ribose-phosphate diphosphokinase" amino acids 1 to 311 (311 residues), 376.3 bits, see alignment E=4.6e-117 PF13793: Pribosyltran_N" amino acids 1 to 117 (117 residues), 179.5 bits, see alignment E=2.6e-57 PF00156: Pribosyltran" amino acids 151 to 267 (117 residues), 74 bits, see alignment E=1.4e-24 PF14572: Pribosyl_synth" amino acids 200 to 310 (111 residues), 85.2 bits, see alignment E=8.8e-28

Best Hits

Swiss-Prot: 73% identical to KPRS_BRUSU: Ribose-phosphate pyrophosphokinase (prs) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 97% identity to sch:Sphch_2333)

MetaCyc: 54% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF3300 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (Sphingobium sp. HT1-2)
MKLMTGNSNKPLAAAIADYIEIPLTEASVRRFADEEVFVEIHENVRGEDVFVIQSTAYPT
NDNLMELLIMIDALKRASAKRITAVVPYFGYARQDRKPGPRTPISAKLVANLITTAGADR
VLSVDLHAGQIQGFFDIPTDNLFGAPVMSADIQARFGDKNIMVVSPDVGGVVRARALAKR
LDNAPLAIVDKRRERAGESEVMNIIGDVKGRFCILIDDIVDSAGTLCNAAAALKAQGAEE
VVAYVSHGVLSGGAVARVEASELLELVITDSIQGTDAVNEAKRIRHLPIAPLLGEAIKRI
ADESSVSSLFD