Protein Info for PS417_00170 in Pseudomonas simiae WCS417

Annotation: glucarate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 88 to 115 (28 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 392 (367 residues), 201.1 bits, see alignment E=1.2e-63 TIGR00893: D-galactonate transporter" amino acids 28 to 426 (399 residues), 422.3 bits, see alignment E=9.7e-131

Best Hits

Swiss-Prot: 56% identical to DGOT_ECOL6: D-galactonate transporter (dgoT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08194, MFS transporter, ACS family, D-galactonate transporter (inferred from 98% identity to pfs:PFLU0033)

MetaCyc: 56% identical to D-galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-16

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TTY4 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PS417_00170 glucarate transporter (Pseudomonas simiae WCS417)
MHPESFTGQASLVTPTRKRFFIMVLLFITVVINYLDRSNLSIAAPALTSELGIDPVHVGL
IFSAFGWTYAAMQIPGGWLVDRVPPRILYTAALLLWSIATVMLGFAASFIALFVLRMAVG
ALEAPAYPINSRVVTTWFPERERATAIGVYTSGQFVGLAFLTPVLAWLQHAFGWHMVFVA
TGGVGIVWAVIWYAVYREPKEFKGANTAEIDLIREGGGLVDMQEKAAKAPFSWVDLGIVL
SKRKLWGIYLGQFCLNSTLWFFLTWFPTYLVKYRGMDFIKSGLLASLPFLAAFVGVLCSG
IFSDWLIRRGASVGFARKLPIIGGLLISTAIIGANYVDSTAWVIAFLAVAFFGNGLASIT
WSLVSTLAPARLLGLTGGVFNFIGNLSAIATPIVIGFLASGDSFAPAITYIAVLALLGAL
SYVLLVGKVERIELK