Protein Info for GFF3296 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Urease accessory protein UreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to URED_RHOFT: Urease accessory protein UreD (ureD) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03190, urease accessory protein (inferred from 60% identity to rfr:Rfer_3376)

Predicted SEED Role

"Urease accessory protein UreD" in subsystem Urea decomposition

MetaCyc Pathways

urea degradation II (1/1 steps found)
superpathway of allantoin degradation in plants (2/8 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF3296 Urease accessory protein UreD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPWHAQLDLHYRRDDAQRTVLQHAHTGPLRILKSLYPEGEGICHNVVVHPPGGLVGGDTL
DLRVRAGAQAHGLLSTPGATRFYRSDGPTATQQVELALEAGARLEWLPLEAIAYPGCLAQ
NTLRATLAEEAELIGWDVCALGLPTAGQPFDRGSLTQHLEIPGLWLERSRIDAADTRLLE
SPLGLAGQRCLGTLWLACGTPLTRERREHLLEAVRAQLEGDLEGVQAGATCPNPQMLVLR
AVAPLVEPLMALFQRVWAALRTEAWGLSAVPPRIWRV