Protein Info for GFF3295 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cobalt-zinc-cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 24 to 288 (265 residues), 204.1 bits, see alignment E=1.4e-64 PF01545: Cation_efflux" amino acids 30 to 236 (207 residues), 128.4 bits, see alignment E=1.6e-41

Best Hits

KEGG orthology group: None (inferred from 70% identity to alv:Alvin_1529)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF3295 Cobalt-zinc-cadmium resistance protein CzcD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNHSHALPGWRHSHVFGEGNPLAERNTKWAVLLTAAMMVAEIAGGWIYNSMALLADGWHM
SSHALALGLSAAAYVAARRLSGDGRFAFGTWKIEILGSYSSAILLVLVALFMLYHSVERL
LAPTAIHYDQAIAIAVVGLLVNLACAWLLRGGHGHDHGHDHHHHHGDHAAPQDLNLRAAY
LHVVADAATSALAIVALFGGKLWGAAWLDPVMGIVGAGLVAAWAVGLLRDSGRVLLDAEM
SAPVVQEIRDAIAAGPVRAELCDLHVWRVGADQYACIVSLATAEAAGPDDFKRLLRVHEE
LVHISVEVNRVPAAA