Protein Info for GFF3294 in Variovorax sp. SCN45

Annotation: Cardiolipin synthase (EC 2.7.8.-) bacterial type ClsB, has minor trans-phosphatidylation activity converting PE to PG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 28 to 138 (111 residues), 51.5 bits, E=9.1e-18
  • amino acids 219 to 345 (127 residues), 109.4 bits, E=1.2e-35
• PF00614: PLDc
  • amino acids 111 to 133 (23 residues), 30.6 bits, see alignment (E = 2.5e-11)

Best Hits

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 86% identity to vpe:Varpa_0012)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Protein Sequence (423 amino acids)

>GFF3294 Cardiolipin synthase (EC 2.7.8.-) bacterial type ClsB, has minor trans-phosphatidylation activity converting PE to PG (Variovorax sp. SCN45)
MNNNNHWTGGNRVELLENGEAFFPRVFEAIRQAKREAIVETFILFEDKVGLQLHAAMREA
ALRGVKVDLMIDGFGSPDLSREFIEGLTSAGVKVRVFDPGQRFLGKRLNVFRRMHRKIVV
IDGERAFVGGINYSADHLLDFGPKAKQDYAVELHGPIVAEIHQFVLRAIALGGKGAGWFR
RRLRQAPAAVAHAPAGEADAMFVTRDNRHHTNDIEQQYRAAIRAARERIVIANAYFFPGY
RLIKELRRAARRGVDVRLILQGEPDMPIVKTAASMLYHHLLHAGVRIYEYCDRPLHGKVA
LMDDKWSTVGSSNLDPLSLSLNLESNVIVRDQAFNAVLSERLDHLMQHSCKQIDTADLAS
EWSGWRLVRSFFVFHILRWYPALLGRLPRHVPRLTLAEATELASRRDTGTSHPTGGATQT
EAA