Protein Info for GFF3293 in Variovorax sp. SCN45

Annotation: Inner membrane protein YbhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 72 (23 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 239 to 273 (35 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 24 to 298 (275 residues), 74.1 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 44% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 82% identity to vpe:Varpa_0011)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF3293 Inner membrane protein YbhQ (Variovorax sp. SCN45)
MSTMALSRQSWWPWVRRAAVWGFFALIAWLLVRQARTIDWDDVLDAIRALPATTLLAAGA
MAACSFVLYSTYDLLGRHLTRHRLGTGTVMGVTFISYAFNLNLGSLVGGVAFRYRLYSRL
GLGNETITRVLGFSMFTNWIGYLLVAGVAFCFWPLDLPPGWKIGNDGLRMLGAVLLMLAF
AYVLLCAFVRGRVWRVRGHAFKTPGLAMALLQLAMSCANWSLIGGVIWFLLQGAVGYPHV
LAVLLVAAVAGVVTHVPAGLGVLEAVFVALLAHQVPEATLLGALLAYRGLYYLLPLTVAT
LGYLVTEVRARRLQKR