Protein Info for GFF3290 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 278 (272 residues), 97.1 bits, see alignment E=5.2e-32

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 63% identity to ctt:CtCNB1_1146)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF3290 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MALIDALLNGLTLGGVYALIAMGLTLQYGVARIMNLAYGQMLVAAAFAAYALFTTFALSP
LLGLLLIAPAAFALNWLLYQLLLTPLVRRARTSEALEVDSILATFGLLFVIEGIVLVIFG
GNYYNYDYLGQVITLLGSPLKANRLLALGFAVVIGVGLYLVLHHTRRGTALRAVAVSPTS
AQLVAIDVRKAAAFAFALGGGLVAASGTLVSMFFTINASMGVVFTMKALIVVIMGGVGNL
MGCLVAGLLLGLTESLVATFVSPGLTLAVTFGLFLLVLIIRPTGMFGKAGA