Protein Info for GFF3288 in Sphingobium sp. HT1-2

Annotation: Uncharacterized integral membrane protein Mlr5338

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 133 to 160 (28 residues), see Phobius details amino acids 186 to 216 (31 residues), see Phobius details PF07264: EI24" amino acids 6 to 205 (200 residues), 76.8 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 71% identity to sjp:SJA_C1-03110)

Predicted SEED Role

"FIG01096748: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF3288 Uncharacterized integral membrane protein Mlr5338 (Sphingobium sp. HT1-2)
MIITAALRAFPLIFHAAARRLLVKTLALTLLLFALLGVGLWAAFHATRLHFGWGEGDGWG
GMAEAAATGLAMIAASWLLFRTIAMLVMGLFADDVIEAVERDTYPQAVGRPVGFTRSLHY
ALRSVGRTLGWNLVALPGYVLLLVTGVGTIGLFLAVNAYLLGRDLADMVEPRHPALPPIG
RGNRWLMGLVSALLFLIPLVNLLAPIWSAAMAVHMLLGSKRKPV