Protein Info for GFF3288 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 16 to 161 (146 residues), 102.2 bits, E=3.9e-33
• PF12399: BCA_ABC_TP_C
  • amino acids 214 to 238 (25 residues), 28.6 bits, see alignment (E = 8.9e-11)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 64% identity to ctt:CtCNB1_1144)

MetaCyc: 38% identical to lipopolysaccharide transport system ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

MetaCyc Pathways

• Brucella abortus lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (238 amino acids)

>GFF3288 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
LQVNGLVKRFGGLVAVNGVDFSVAQGEIVGLLGPNGSGKTTVINLISGALPPTAGSVTLQ
GQELTGLPAFRVARAGVARTFQLVRVLGSMDCVENVQAGLAFGTQNLPQRASRAQALKLL
ERVGMADFAHTTASELTYINQKRLELARALALRPRLLLLDEWLSGLNPSELVDGIALLRS
LREEGITMLMVEHVMEAIRALCDRCVIMNAGTRIADGPPAAALAEPAVVRAYLGDDDA