Protein Info for GFF3286 in Sphingobium sp. HT1-2

Annotation: Epoxyqueuosine reductase (EC 1.17.99.6) QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00276: epoxyqueuosine reductase" amino acids 12 to 345 (334 residues), 447.3 bits, see alignment E=1.5e-138 PF08331: QueG_DUF1730" amino acids 61 to 137 (77 residues), 84.5 bits, see alignment E=3.7e-28 PF13484: Fer4_16" amino acids 189 to 253 (65 residues), 80.2 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 62% identical to QUEG_ROSLO: Epoxyqueuosine reductase (queG) from Roseobacter litoralis (strain ATCC 49566 / DSM 6996 / JCM 21268 / NBRC 15278 / OCh 149)

KEGG orthology group: None (inferred from 87% identity to sch:Sphch_2320)

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF3286 Epoxyqueuosine reductase (EC 1.17.99.6) QueG (Sphingobium sp. HT1-2)
MPVQNETLEQRLKAQAAQLGFAACAIARADAAPRTAERLRQWLEAGHHGDMLWMEERAEQ
RGSPTGLWPEARSVIMLGMSYAPGRDPLALAEVGDRGRISVYAQGRDYHDVVKKALKALA
RWLVDQQPTALKVFVDTAPVMEKPLAQGAGLGWQGKHSNLVSRQHGSWLFLGAIYTEIAL
EPDAPEVDHCGSCTACLSSCPTDAFPAPYIVDARRCISYLTIEHKGPIPEEFRARMGNRI
YGCDDCLAACPWNKFAQGAAANRAFIGRAELAAPALGDLLDLDDAGFREIFSGSPIKRIG
RDRMVRNAAIAAGNSGDLGLVDRLRPLTSDPDPVVAEAAEWALGQLLSAAGA