Protein Info for GFF3286 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribonuclease Z (EC 3.1.26.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00753: Lactamase_B" amino acids 55 to 218 (164 residues), 43.6 bits, see alignment E=3.3e-15 PF12706: Lactamase_B_2" amino acids 64 to 277 (214 residues), 66.3 bits, see alignment E=3.1e-22

Best Hits

KEGG orthology group: None (inferred from 99% identity to spt:SPA1741)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.11

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF3286 Ribonuclease Z (EC 3.1.26.11) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMKKSVAMLAVCMLAQSHLAIAAGTPAPQEINIVLLGTKGGPSLLNTARLPQATALTIGD
KIWLIDAGYGASLQLVKNGIPLRNINTILLTHLHSDHILDYPSLLMNAWASGLKDHTIQV
YGPPGTQAMTKASWKVFDRDITLRMEEEGKPDPRNLVKATDIGQGVIYKDELVTISALKV
PHSPFPDGEAFAYRFDTQGKRIVFSGDTSWFPPLATFAQGADILVHEAVHVPSVAKLANS
IGNGKTLAEAIASHHTTIEDVGKIARESHVKKLVLSHLVPATVADDVWQQEAMKNYPGPV
IVGHDNMTISVP