Protein Info for GFF3284 in Xanthobacter sp. DMC5

Annotation: Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF00590: TP_methylase" amino acids 23 to 201 (179 residues), 62.8 bits, see alignment E=2.3e-21 TIGR02467: precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit" amino acids 25 to 209 (185 residues), 150.5 bits, see alignment E=4.1e-48 TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit" amino acids 248 to 369 (122 residues), 110.4 bits, see alignment E=7e-36

Best Hits

Swiss-Prot: 59% identical to COBL_SINSX: Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] (cobL) from Sinorhizobium sp.

KEGG orthology group: K00595, precorrin-6Y C5,15-methyltransferase / precorrin-8W decarboxylase [EC: 1.-.-.- 2.1.1.132] (inferred from 84% identity to xau:Xaut_3280)

MetaCyc: 59% identical to precorrin-6B (C5,15) methyltransferase subunit (Pseudomonas denitrificans (nom. rej.))
Precorrin-6Y C(5,15)-methyltransferase (decarboxylating). [EC: 2.1.1.132]

Predicted SEED Role

"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.132

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>GFF3284 Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] (Xanthobacter sp. DMC5)
MWGFMADAEGIIAADTAPAGRWLSIVGIGEDGAEGLSPAARAAISAAAIVFGGARHLALA
GDLVKGEARVWPSPFSLDGVLAARGQRVCVLASGDPFLYGVGASLARHVPAEEMSAFPAP
SAFALAAARLGWAQQEVDLLSLHGRPLARLRPFLQDGARLLLLTSDGDGPAQVAAFATAH
GCGASLLTVLEALGGPAERIRSAMAEGFDLSDVAALNVVALEVRAAPDAPILPLAAGLAD
DLFEHDGQITKREVRALTLSSLAPRRGELLWDIGAGAGSIAIEWLLAHPSLSAIAIEGNA
ERAARIGRNAQKLGVPHLKVVEGAAPGALAGLPTPDVIFIGGGASEPGVFDTALAALKPG
GRMVANAVTLETEALLIAAHARLGGTLTRISLARSVAVKGMTGWRPAMPVTQWRWEKSRQ
GEGA