Protein Info for GFF3280 in Variovorax sp. SCN45

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF11638: DnaA_N" amino acids 8 to 70 (63 residues), 65.4 bits, see alignment E=7.7e-22 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 11 to 457 (447 residues), 555.4 bits, see alignment E=5.4e-171 PF00308: Bac_DnaA" amino acids 124 to 284 (161 residues), 203.4 bits, see alignment E=6.8e-64 PF00004: AAA" amino acids 161 to 280 (120 residues), 30.7 bits, see alignment E=1e-10 PF01695: IstB_IS21" amino acids 161 to 261 (101 residues), 31.1 bits, see alignment E=4.3e-11 PF08299: Bac_DnaA_C" amino acids 368 to 436 (69 residues), 112.8 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 62% identical to DNAA_HERAR: Chromosomal replication initiator protein DnaA (dnaA) from Herminiimonas arsenicoxydans

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 99% identity to vpe:Varpa_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>GFF3280 Chromosomal replication initiator protein DnaA (Variovorax sp. SCN45)
MSTDGIGESLWQACVDQLAQELSEQQFNTWIKPLTAQVADDLSRMTVFVANRFKLDWIRA
QYAGKIAAMAEKMYGQPVAIELALAPRETPVRSAPVAVMTETDVPRDVAGPGEEPAAAGF
KNRLNSGLTFDTLVEGTANRMARAAAMHVAGMPGHLYNPLFIYGGVGLGKTHLMHAVGNR
LLADRADSKVLYIHAEQFVSDVVKAYQRKTFDEFKERYHSLDLLLIDDVQFFANKDRTQE
EFFNAFEALLAKKSHIVMTSDTYPKGLADIHERLVSRFDSGLTVAIEPPELEMRVAILIN
KARAESAEMPEEVAFFVAKNVRSNVRELEGALRKILAYSRFNQKEISIALAREALRDLLS
IQNRQISVENIQKTVADYYKIKVADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGEL
FGGRDHTTVLHAVRKISGERQQLTELNQQLHVLEQTLKG