Protein Info for GFF328 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-seryl-tRNA(Sec) selenium transferase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR01437: uncharacterized pyridoxal phosphate-dependent enzyme" amino acids 5 to 363 (359 residues), 547.8 bits, see alignment E=5.1e-169 PF03841: SelA" amino acids 14 to 284 (271 residues), 67.1 bits, see alignment E=7.7e-23

Best Hits

Swiss-Prot: 100% identical to DGAE_SALT1: D-glucosaminate-6-phosphate ammonia lyase (dgaE) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to stm:STM3768)

MetaCyc: 100% identical to D-glucosaminate 6-phosphate ammonia-lyase (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN-14730 [EC: 4.3.1.29]

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.9.1.1, 4.3.1.-

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.- or 4.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF328 L-seryl-tRNA(Sec) selenium transferase-related protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTPNIYQQLGLKKVINACGKMTILGVSSVAPEVMQATARAASAFVEIDALVEKTGELVSR
YTGAEDSYITSCASAGIAIAVAAAITHGDRARVALMPDSSGMANEVVMLRGHNVDYGAPV
TSAIRLGGGRIVEVGSSNLATRWQLESAINEKTAALLYVKSHHCVQKGMLSIDDFVQVAQ
ANHLPLIVDAAAEEDLRGWVASGADMVIYSGAKAFNAPTSGFITGRKTWIAACKAQHQGI
ARAMKIGKENMVGLVYALENYHQGQTTVTAAQLQPVAEAISAIHGLYADIEQDEAGRAIW
RIRVRVNASELGLNAQDVEAQLRGGEIAIYARKYQLHQGVFSLDPRTVAEGEMALIVARL
REIAEHAAD