Protein Info for PS417_16785 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 205 to 219 (15 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 260 to 291 (32 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 324 (280 residues), 114 bits, see alignment E=3.5e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to pfs:PFLU3854)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYP6 at UniProt or InterPro

Protein Sequence (349 amino acids)

>PS417_16785 ABC transporter permease (Pseudomonas simiae WCS417)
MSIPVAQDTAPLLLIQRRIPWALIGLLALAFIVVPLWGNDYWLNAILIPFLVLSLAGLGL
NLLTGYTGQTSVGAAGFMAVGAFATYGFLLRLPELGLPVALLGGGIISALVGLLFGLPSS
RIKGFYLMVTTLAAQFFLEWLFVKFPWFYNYGSSGTISAPKLALFGHDLNTPLGRYLLTL
VTVLLLTWTAINLVRSQVGRNWMAIRDMDTAAAVVGIPVVRYKRLAFAVSSFYLGIAGAL
WAFAYLGTASASSFDINRSFQILFIIIIGGMGSIAGNFVGAAFISLLPIFLSHAGQALFG
GSVDAGQLQNLQKIIFGVLIIVFLIKEPEGLIRLLHNLRDRVRQWPLRF