Protein Info for GFF3278 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02305: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit" amino acids 3 to 203 (201 residues), 283.8 bits, see alignment E=6.8e-89 PF01557: FAA_hydrolase" amino acids 4 to 204 (201 residues), 149.9 bits, see alignment E=4.3e-48 amino acids 225 to 423 (199 residues), 222.6 bits, see alignment E=2.5e-70 TIGR02303: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit" amino acids 208 to 425 (218 residues), 372.8 bits, see alignment E=7.3e-116

Best Hits

Swiss-Prot: 97% identical to HPAG_SALDU: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase (hpaG) from Salmonella dublin

KEGG orthology group: K05921, 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase [EC: 4.1.1.68 5.3.3.-] (inferred from 99% identity to sed:SeD_A1176)

MetaCyc: 83% identical to 5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioate decarboxylase (Escherichia coli W)
5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase. [EC: 4.1.1.68]

Predicted SEED Role

"5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation (EC 4.1.1.68, EC 5.3.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.68 or 5.3.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>GFF3278 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKGTVFAVALNHRSQLDAWREAFSQPPYNAPPKTAVWFIKPRNTVIRHGEPIPYPQGEKV
LSGATVALIVGKTASRIRPEAAADYIAGYALANEVSLPEESFYRPAIKAKCRDGFCPLGE
MAPLSDVDNLTIITEINGREADHWNTADLQRSAAQLLSALSEFATLNPGDAILLGTPQNR
VALRPGDRVRILAKGLPALENPVVAEDEFARHQTFTWPLSATGTLFALGLNYADHASELA
FTPPKEPLVFIKAPNTFTEHHQTSVRPNNVEYMHYEAELVVVIGKTARKVSEAEAMEYVA
GYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPIGPWIVDKEAVSDPHNLTLRTFVNGELR
QEGTTADLIFSIPFLISYLSEFMTLQPGDMIATGTPKGLSDVVPGDEVVVEVEGVGRLVN
RIVSEESAK