Protein Info for GFF3275 in Variovorax sp. SCN45

Annotation: tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF10396: TrmE_N" amino acids 9 to 135 (127 residues), 118.7 bits, see alignment E=3.3e-38 TIGR00450: tRNA modification GTPase TrmE" amino acids 13 to 468 (456 residues), 295 bits, see alignment E=1.2e-91 PF12631: MnmE_helical" amino acids 138 to 465 (328 residues), 205.8 bits, see alignment E=1.7e-64 TIGR00231: small GTP-binding protein domain" amino acids 231 to 360 (130 residues), 67 bits, see alignment E=1.7e-22 PF01926: MMR_HSR1" amino acids 233 to 355 (123 residues), 80.4 bits, see alignment E=2.3e-26 PF02421: FeoB_N" amino acids 233 to 316 (84 residues), 31.4 bits, see alignment E=2.6e-11

Best Hits

Swiss-Prot: 73% identical to MNME_ACIAC: tRNA modification GTPase MnmE (mnmE) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 95% identity to vpe:Varpa_6019)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>GFF3275 tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmE (Variovorax sp. SCN45)
MLARTTDPIVAIATASGRGAVGIVRVSGARLAPLIEAICGRVLKPREATYLPFRDAGGEP
VDHGLAIHFPSPNSFTGEDVLELQAHGGAVVLQLLLARCLEAAAEPDPVTGRPRLPGLRV
AEPGEFSQRAFLNGKIDLAQAEAIADLIDASTEAAARSAGRSLSGAFSREIHTLRDALIH
LRMLVEATLDFPEEEIDFLQKADAAGQLAKLQSQLAAVQQRARQGALLREGIKVVIAGQP
NAGKSSLLNALAGAELAIVSAVAGTTRDVVSQTIQIHGVPLHVADTAGLRESSDEVEQIG
VARAWGQIESADAVLFLHDLTRAALPDYAAADAEILAGLRRKLPASVPVLDVWNKQDAAP
STEPAEGIALSAKTGLGIEALREQLLAMAGWQAVPEGVYLARARHVQALAQVEAHLALAA
SHLAAQAQLLDLLAEELRLAQNALNEITGEFGADDLLGVIFSRFCIGK