Protein Info for GFF3271 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 202 to 225 (24 residues), see Phobius details PF08269: dCache_2" amino acids 48 to 186 (139 residues), 102.4 bits, see alignment E=6.9e-33 PF17200: sCache_2" amino acids 48 to 189 (142 residues), 123.6 bits, see alignment E=1.6e-39 PF17201: Cache_3-Cache_2" amino acids 78 to 191 (114 residues), 43.7 bits, see alignment E=5.7e-15 PF07730: HisKA_3" amino acids 249 to 309 (61 residues), 47.1 bits, see alignment E=6.9e-16 PF02518: HATPase_c" amino acids 350 to 439 (90 residues), 45.4 bits, see alignment E=2.5e-15

Best Hits

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 64% identity to mpt:Mpe_A1027)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF3271 Sensor histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRLRTKILLLAILPLLASLVLIALAVQHQERDLARREYALVERTYLEARRAELRNYVALA
ASTVQPLYDRGGNEAADREQALRLLASLDYGRDGYFFVYDLQGRVLMHSRQPELVGQNLW
ELRDPQGRPTIQRLIAQARAGGGFVDYLWRQPSSGKDTPKLGYVMAYERWGWMLGTGLYL
DGIQATLTRIEGEANRNIATTLLWIAGIAVFGIALISASGLALNLSEHRVAENKLRLLAR
QVQQSQEDERARLARELHDGISQTLVSTKLLVEAGADTRDPEPLAKALQGLNHTLVEVRR
ISHALRPALLDTLGLPAALQHLGQEFEDASGLPVAVRIEGTERELPDEVKTALFRVAQES
LTNVAKHARATQVEIVLAFGPGEGLRMGVTDDGRGFDSAAVHLHPERGIGLRNMRERLAA
IGGRLSIQAEPGHGTQIEAKT