Protein Info for PS417_01665 in Pseudomonas simiae WCS417

Annotation: GTP-binding protein TypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00009: GTP_EFTU" amino acids 4 to 195 (192 residues), 192.5 bits, see alignment E=1.7e-60 TIGR01394: GTP-binding protein TypA/BipA" amino acids 5 to 599 (595 residues), 934.7 bits, see alignment E=1.8e-285 TIGR00231: small GTP-binding protein domain" amino acids 5 to 139 (135 residues), 78.9 bits, see alignment E=3.7e-26 PF01926: MMR_HSR1" amino acids 8 to 129 (122 residues), 25.2 bits, see alignment E=4.4e-09 PF22042: EF-G_D2" amino acids 207 to 289 (83 residues), 28 bits, see alignment E=5.7e-10 PF03144: GTP_EFTU_D2" amino acids 219 to 289 (71 residues), 40.7 bits, see alignment E=7.9e-14 PF00679: EFG_C" amino acids 397 to 477 (81 residues), 76.8 bits, see alignment E=3.3e-25 PF21018: BipA_C" amino acids 485 to 594 (110 residues), 158.3 bits, see alignment E=1.5e-50

Best Hits

Swiss-Prot: 70% identical to TYPA_SHIFL: GTP-binding protein TypA/BipA (typA) from Shigella flexneri

KEGG orthology group: K06207, GTP-binding protein (inferred from 98% identity to pfs:PFLU0350)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUB7 at UniProt or InterPro

Protein Sequence (606 amino acids)

>PS417_01665 GTP-binding protein TypA (Pseudomonas simiae WCS417)
MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDSNDQEKERGITILAKN
TAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDGPMPQTRFVTKKAFEAG
LRPIVCINKVDRPGARPDWVLDQIFDLFDNLGATEEQLDFKVVYASALNGIAGLDHTDMA
EDMTPLYQSIVDNVPAPAVDRDGAFQMQISALDYNSFLGVIGVGRIARGRVKPNTPVVAI
GADGKKRNGRILKLMGHHGLHRIDVEEAAAGDIVCISGMDSLFISDTLCHPDTVEAMKPL
TVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKERLDKELLYNVALRVEEGDSADKFKVSG
RGELHLSVLIETMRREGFEMGVGRPEVIIRQVDGVKQEPFENVTIDTPEESQGKVMEEMG
LRKGDLTNMVPDGKGRVRLEYNIPARGLIGFRNQFLTLTNGAGILTSIFDRYDTMKSGDM
SGRQNGVLVSVETGKALTYSLETLQARGKLFVEHGQEIYNGQIVGLNSRDNDMGVNPTKG
KKLDNMRASGKDETIALVPPVRFTLEQALEFIQDDELCEVTPKSIRLRKKILDEGERTRA
AKKAKN